Anti HPS5 pAb (ATL-HPA077851)

Atlas Antibodies

SKU: ATL-HPA077851-25

• 
• 

Protein Description: HPS5, biogenesis of lysosomal organelles complex 2 subunit 2
Gene Name: HPS5
Alternative Gene Name: AIBP63, BLOC2S2, RU2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014418: 54%, ENSRNOG00000055531: 55%
Entrez Gene ID: 11234
Uniprot ID: Q9UPZ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NEESVDKTACECVRSPRESLDDLFQICSPCAIASGLRNDLAELTTLCLELNVLNSKIKSTSGHVDHTLQQYSPEIL
• Gene Sequence: NEESVDKTACECVRSPRESLDDLFQICSPCAIASGLRNDLAELTTLCLELNVLNSKIKSTSGHVDHTLQQYSPEIL
• Gene ID - Mouse: ENSMUSG00000014418
• Gene ID - Rat: ENSRNOG00000055531
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.