Anti HPS3 pAb (ATL-HPA052778)

Atlas Antibodies

Catalog No.:
ATL-HPA052778-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Hermansky-Pudlak syndrome 3
Gene Name: HPS3
Alternative Gene Name: BLOC2S1, SUTAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027615: 82%, ENSRNOG00000031406: 77%
Entrez Gene ID: 84343
Uniprot ID: Q969F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVNWRNKRTENSRVCIRMIGHNVEGPFSKAFRDQMYIIEMPLSEAPLCISCCPVKGDLLVGCTNKLVLFSLKYQIINEEFSLLDFER
Gene Sequence YVNWRNKRTENSRVCIRMIGHNVEGPFSKAFRDQMYIIEMPLSEAPLCISCCPVKGDLLVGCTNKLVLFSLKYQIINEEFSLLDFER
Gene ID - Mouse ENSMUSG00000027615
Gene ID - Rat ENSRNOG00000031406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HPS3 pAb (ATL-HPA052778)
Datasheet Anti HPS3 pAb (ATL-HPA052778) Datasheet (External Link)
Vendor Page Anti HPS3 pAb (ATL-HPA052778) at Atlas Antibodies

Documents & Links for Anti HPS3 pAb (ATL-HPA052778)
Datasheet Anti HPS3 pAb (ATL-HPA052778) Datasheet (External Link)
Vendor Page Anti HPS3 pAb (ATL-HPA052778)