Anti HPS1 pAb (ATL-HPA061260)
Atlas Antibodies
- Catalog No.:
- ATL-HPA061260-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HPS1
Alternative Gene Name: HPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025188: 75%, ENSRNOG00000045838: 74%
Entrez Gene ID: 3257
Uniprot ID: Q92902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKKLKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQEIQSTWLEFKAKAFSK |
| Gene Sequence | LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKKLKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQEIQSTWLEFKAKAFSK |
| Gene ID - Mouse | ENSMUSG00000025188 |
| Gene ID - Rat | ENSRNOG00000045838 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HPS1 pAb (ATL-HPA061260) | |
| Datasheet | Anti HPS1 pAb (ATL-HPA061260) Datasheet (External Link) |
| Vendor Page | Anti HPS1 pAb (ATL-HPA061260) at Atlas Antibodies |
| Documents & Links for Anti HPS1 pAb (ATL-HPA061260) | |
| Datasheet | Anti HPS1 pAb (ATL-HPA061260) Datasheet (External Link) |
| Vendor Page | Anti HPS1 pAb (ATL-HPA061260) |