Anti HPS1 pAb (ATL-HPA061260)

Atlas Antibodies

Catalog No.:
ATL-HPA061260-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Hermansky-Pudlak syndrome 1
Gene Name: HPS1
Alternative Gene Name: HPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025188: 75%, ENSRNOG00000045838: 74%
Entrez Gene ID: 3257
Uniprot ID: Q92902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKKLKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQEIQSTWLEFKAKAFSK
Gene Sequence LWQGINLVLLTRSPSAPLALVLSQLMDGFSMLEKKLKEGPEPGASLRSQPLVGDLRQRMDKFVKNRGAQEIQSTWLEFKAKAFSK
Gene ID - Mouse ENSMUSG00000025188
Gene ID - Rat ENSRNOG00000045838
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HPS1 pAb (ATL-HPA061260)
Datasheet Anti HPS1 pAb (ATL-HPA061260) Datasheet (External Link)
Vendor Page Anti HPS1 pAb (ATL-HPA061260) at Atlas Antibodies

Documents & Links for Anti HPS1 pAb (ATL-HPA061260)
Datasheet Anti HPS1 pAb (ATL-HPA061260) Datasheet (External Link)
Vendor Page Anti HPS1 pAb (ATL-HPA061260)