Anti HPDL pAb (ATL-HPA057346)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057346-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HPDL
Alternative Gene Name: 4-HPPD-L, GLOXD1, MGC15668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043155: 83%, ENSRNOG00000018143: 85%
Entrez Gene ID: 84842
Uniprot ID: Q96IR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLDPRHAVPSATTLCFDV |
| Gene Sequence | ALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLDPRHAVPSATTLCFDV |
| Gene ID - Mouse | ENSMUSG00000043155 |
| Gene ID - Rat | ENSRNOG00000018143 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HPDL pAb (ATL-HPA057346) | |
| Datasheet | Anti HPDL pAb (ATL-HPA057346) Datasheet (External Link) |
| Vendor Page | Anti HPDL pAb (ATL-HPA057346) at Atlas Antibodies |
| Documents & Links for Anti HPDL pAb (ATL-HPA057346) | |
| Datasheet | Anti HPDL pAb (ATL-HPA057346) Datasheet (External Link) |
| Vendor Page | Anti HPDL pAb (ATL-HPA057346) |