Anti HPDL pAb (ATL-HPA057346)

Atlas Antibodies

Catalog No.:
ATL-HPA057346-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: 4-hydroxyphenylpyruvate dioxygenase-like
Gene Name: HPDL
Alternative Gene Name: 4-HPPD-L, GLOXD1, MGC15668
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043155: 83%, ENSRNOG00000018143: 85%
Entrez Gene ID: 84842
Uniprot ID: Q96IR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLDPRHAVPSATTLCFDV
Gene Sequence ALRLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLDPRHAVPSATTLCFDV
Gene ID - Mouse ENSMUSG00000043155
Gene ID - Rat ENSRNOG00000018143
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HPDL pAb (ATL-HPA057346)
Datasheet Anti HPDL pAb (ATL-HPA057346) Datasheet (External Link)
Vendor Page Anti HPDL pAb (ATL-HPA057346) at Atlas Antibodies

Documents & Links for Anti HPDL pAb (ATL-HPA057346)
Datasheet Anti HPDL pAb (ATL-HPA057346) Datasheet (External Link)
Vendor Page Anti HPDL pAb (ATL-HPA057346)