Anti HPD pAb (ATL-HPA038322 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038322-100

Protein Description: 4-hydroxyphenylpyruvate dioxygenase
Gene Name: HPD
Alternative Gene Name: 4-HPPD, 4HPPD, GLOD3, PPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029445: 85%, ENSRNOG00000001338: 83%
Entrez Gene ID: 3242
Uniprot ID: P32754
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQP
• Gene Sequence: REPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQP
• Gene ID - Mouse: ENSMUSG00000029445
• Gene ID - Rat: ENSRNOG00000001338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HPD pAb (ATL-HPA038322 w/enhanced validation) – 2 Found

Colemonts-Vroninks, Haaike; Neuckermans, Jessie; Marcelis, Lionel; Claes, Paul; Branson, Steven; Casimir, Georges; Goyens, Philippe; Martens, Geert A; Vanhaecke, Tamara; De Kock, Joery. Oxidative Stress, Glutathione Metabolism, and Liver Regeneration Pathways Are Activated in Hereditary Tyrosinemia Type 1 Mice upon Short-Term Nitisinone Discontinuation. Genes. 2020;12(1) 

Ibraheim, Raed; Tai, Phillip W L; Mir, Aamir; Javeed, Nida; Wang, Jiaming; Rodríguez, Tomás C; Namkung, Suk; Nelson, Samantha; Khokhar, Eraj Shafiq; Mintzer, Esther; Maitland, Stacy; Chen, Zexiang; Cao, Yueying; Tsagkaraki, Emmanouela; Wolfe, Scot A; Wang, Dan; Pai, Athma A; Xue, Wen; Gao, Guangping; Sontheimer, Erik J. Self-inactivating, all-in-one AAV vectors for precision Cas9 genome editing via homology-directed repair in vivo. Nature Communications. 2021;12(1):6267.