Anti HP1BP3 pAb (ATL-HPA054295)

Atlas Antibodies

Catalog No.:
ATL-HPA054295-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: heterochromatin protein 1, binding protein 3
Gene Name: HP1BP3
Alternative Gene Name: HP1-BP74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028759: 98%, ENSRNOG00000014445: 91%
Entrez Gene ID: 50809
Uniprot ID: Q5SSJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
Gene Sequence ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
Gene ID - Mouse ENSMUSG00000028759
Gene ID - Rat ENSRNOG00000014445
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HP1BP3 pAb (ATL-HPA054295)
Datasheet Anti HP1BP3 pAb (ATL-HPA054295) Datasheet (External Link)
Vendor Page Anti HP1BP3 pAb (ATL-HPA054295) at Atlas Antibodies

Documents & Links for Anti HP1BP3 pAb (ATL-HPA054295)
Datasheet Anti HP1BP3 pAb (ATL-HPA054295) Datasheet (External Link)
Vendor Page Anti HP1BP3 pAb (ATL-HPA054295)