Anti HP1BP3 pAb (ATL-HPA054295)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054295-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HP1BP3
Alternative Gene Name: HP1-BP74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028759: 98%, ENSRNOG00000014445: 91%
Entrez Gene ID: 50809
Uniprot ID: Q5SSJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME |
Gene Sequence | ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME |
Gene ID - Mouse | ENSMUSG00000028759 |
Gene ID - Rat | ENSRNOG00000014445 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HP1BP3 pAb (ATL-HPA054295) | |
Datasheet | Anti HP1BP3 pAb (ATL-HPA054295) Datasheet (External Link) |
Vendor Page | Anti HP1BP3 pAb (ATL-HPA054295) at Atlas Antibodies |
Documents & Links for Anti HP1BP3 pAb (ATL-HPA054295) | |
Datasheet | Anti HP1BP3 pAb (ATL-HPA054295) Datasheet (External Link) |
Vendor Page | Anti HP1BP3 pAb (ATL-HPA054295) |