Anti HOXD1 pAb (ATL-HPA056900)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056900-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: HOXD1
Alternative Gene Name: HOX4, HOX4G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042448: 67%, ENSRNOG00000001572: 71%
Entrez Gene ID: 3231
Uniprot ID: Q9GZZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS |
| Gene Sequence | REREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS |
| Gene ID - Mouse | ENSMUSG00000042448 |
| Gene ID - Rat | ENSRNOG00000001572 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HOXD1 pAb (ATL-HPA056900) | |
| Datasheet | Anti HOXD1 pAb (ATL-HPA056900) Datasheet (External Link) |
| Vendor Page | Anti HOXD1 pAb (ATL-HPA056900) at Atlas Antibodies |
| Documents & Links for Anti HOXD1 pAb (ATL-HPA056900) | |
| Datasheet | Anti HOXD1 pAb (ATL-HPA056900) Datasheet (External Link) |
| Vendor Page | Anti HOXD1 pAb (ATL-HPA056900) |