Anti HOXA4 pAb (ATL-HPA060088)

Atlas Antibodies

SKU:
ATL-HPA060088-100
  • Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear bodies.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: homeobox A4
Gene Name: HOXA4
Alternative Gene Name: HOX1, HOX1D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000942: 81%, ENSRNOG00000057095: 81%
Entrez Gene ID: 3201
Uniprot ID: Q00056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
Gene Sequence NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI
Gene ID - Mouse ENSMUSG00000000942
Gene ID - Rat ENSRNOG00000057095
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HOXA4 pAb (ATL-HPA060088)
Datasheet Anti HOXA4 pAb (ATL-HPA060088) Datasheet (External Link)
Vendor Page Anti HOXA4 pAb (ATL-HPA060088) at Atlas Antibodies

Documents & Links for Anti HOXA4 pAb (ATL-HPA060088)
Datasheet Anti HOXA4 pAb (ATL-HPA060088) Datasheet (External Link)
Vendor Page Anti HOXA4 pAb (ATL-HPA060088)