Anti HOXA13 pAb (ATL-HPA069061)

Atlas Antibodies

Catalog No.:
ATL-HPA069061-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: homeobox A13
Gene Name: HOXA13
Alternative Gene Name: HOX1, HOX1J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038203: 98%, ENSRNOG00000053148: 98%
Entrez Gene ID: 3209
Uniprot ID: P31271
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY
Gene Sequence LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY
Gene ID - Mouse ENSMUSG00000038203
Gene ID - Rat ENSRNOG00000053148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HOXA13 pAb (ATL-HPA069061)
Datasheet Anti HOXA13 pAb (ATL-HPA069061) Datasheet (External Link)
Vendor Page Anti HOXA13 pAb (ATL-HPA069061) at Atlas Antibodies

Documents & Links for Anti HOXA13 pAb (ATL-HPA069061)
Datasheet Anti HOXA13 pAb (ATL-HPA069061) Datasheet (External Link)
Vendor Page Anti HOXA13 pAb (ATL-HPA069061)