Anti HOXA11 pAb (ATL-HPA006770)

Atlas Antibodies

Catalog No.: ATL-HPA006770-25

Protein Description: homeobox A11
Gene Name: HOXA11
Alternative Gene Name: HOX1, HOX1I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038210: 100%, ENSRNOG00000061531: 100%
Entrez Gene ID: 3207
Uniprot ID: P31270
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQF
• Gene Sequence: LPQVQPVREVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFYSTVGRNGVLPQAFDQF
• Gene ID - Mouse: ENSMUSG00000038210
• Gene ID - Rat: ENSRNOG00000061531
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HOXA11 pAb (ATL-HPA006770) – 1 Found

Aguiar, Alexis; Galinato, Melissa; Bradley Silva, Maite'; Toth, Bryant; McVoy, Michael A; Hertel, Laura. Human Cytomegalovirus Replication and Infection-Induced Syncytia Formation in Labial, Foreskin, and Fetal Lung Fibroblasts. Viruses. 2021;13(12)