Anti HOPX pAb (ATL-HPA030180 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030180-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HOPX
Alternative Gene Name: HOP, LAGY, NECC1, OB1, SMAP31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059325: 74%, ENSRNOG00000024689: 74%
Entrez Gene ID: 84525
Uniprot ID: Q9BPY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD |
Gene Sequence | MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD |
Gene ID - Mouse | ENSMUSG00000059325 |
Gene ID - Rat | ENSRNOG00000024689 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HOPX pAb (ATL-HPA030180 w/enhanced validation) | |
Datasheet | Anti HOPX pAb (ATL-HPA030180 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HOPX pAb (ATL-HPA030180 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HOPX pAb (ATL-HPA030180 w/enhanced validation) | |
Datasheet | Anti HOPX pAb (ATL-HPA030180 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HOPX pAb (ATL-HPA030180 w/enhanced validation) |
Citations for Anti HOPX pAb (ATL-HPA030180 w/enhanced validation) – 17 Found |
Liang, Dan; Elwell, Angela L; Aygün, Nil; Krupa, Oleh; Wolter, Justin M; Kyere, Felix A; Lafferty, Michael J; Cheek, Kerry E; Courtney, Kenan P; Yusupova, Marianna; Garrett, Melanie E; Ashley-Koch, Allison; Crawford, Gregory E; Love, Michael I; de la Torre-Ubieta, Luis; Geschwind, Daniel H; Stein, Jason L. Cell-type-specific effects of genetic variation on chromatin accessibility during human neuronal differentiation. Nature Neuroscience. 2021;24(7):941-953. PubMed |
Aygün, Nil; Elwell, Angela L; Liang, Dan; Lafferty, Michael J; Cheek, Kerry E; Courtney, Kenan P; Mory, Jessica; Hadden-Ford, Ellie; Krupa, Oleh; de la Torre-Ubieta, Luis; Geschwind, Daniel H; Love, Michael I; Stein, Jason L. Brain-trait-associated variants impact cell-type-specific gene regulation during neurogenesis. American Journal Of Human Genetics. 2021;108(9):1647-1668. PubMed |
Kerimoglu, Cemil; Pham, Linh; Tonchev, Anton B; Sakib, M Sadman; Xie, Yuanbin; Sokpor, Godwin; Ulmke, Pauline Antonie; Kaurani, Lalit; Abbas, Eman; Nguyen, Huong; Rosenbusch, Joachim; Michurina, Alexandra; Capece, Vincenzo; Angelova, Meglena; Maricic, Nenad; Brand-Saberi, Beate; Esgleas, Miriam; Albert, Mareike; Minkov, Radoslav; Kovachev, Emil; Teichmann, Ulrike; Seong, Rho H; Huttner, Wieland B; Nguyen, Huu Phuc; Stoykova, Anastassia; Staiger, Jochen F; Fischer, Andre; Tuoc, Tran. H3 acetylation selectively promotes basal progenitor proliferation and neocortex expansion. Science Advances. 2021;7(38):eabc6792. PubMed |
Kyrousi, Christina; O'Neill, Adam C; Brazovskaja, Agnieska; He, Zhisong; Kielkowski, Pavel; Coquand, Laure; Di Giaimo, Rossella; D' Andrea, Pierpaolo; Belka, Alexander; Forero Echeverry, Andrea; Mei, Davide; Lenge, Matteo; Cruceanu, Cristiana; Buchsbaum, Isabel Y; Khattak, Shahryar; Fabien, Guimiot; Binder, Elisabeth; Elmslie, Frances; Guerrini, Renzo; Baffet, Alexandre D; Sieber, Stephan A; Treutlein, Barbara; Robertson, Stephen P; Cappello, Silvia. Extracellular LGALS3BP regulates neural progenitor position and relates to human cortical complexity. Nature Communications. 2021;12(1):6298. PubMed |
Zhu, Xiaoqing; Guo, Yicheng; Chu, Chu; Liu, Dahai; Duan, Kui; Yin, Yu; Si, Chenyang; Kang, Yu; Yao, Junjun; Du, Xuewei; Li, Junliang; Zhao, Shumei; Ai, Zongyong; Zhu, Qingyuan; Ji, Weizhi; Niu, Yuyu; Li, Tianqing. BRN2 as a key gene drives the early primate telencephalon development. Science Advances. 2022;8(9):eabl7263. PubMed |
Zhao, Ziqi; Zhang, Dan; Yang, Fuqiang; Xu, Mingrui; Zhao, Shaoli; Pan, Taotao; Liu, Chuanyu; Liu, Yongjie; Wu, Qingfeng; Tu, Qiang; Zhou, Ping; Li, Rong; Kang, Jia; Zhu, Lan; Gao, Fei; Wang, Yaqing; Xu, Zhiheng. Evolutionarily conservative and non-conservative regulatory networks during primate interneuron development revealed by single-cell RNA and ATAC sequencing. Cell Research. 2022;32(5):425-436. PubMed |
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
Ju, Xiang-Chun; Hou, Qiong-Qiong; Sheng, Ai-Li; Wu, Kong-Yan; Zhou, Yang; Jin, Ying; Wen, Tieqiao; Yang, Zhengang; Wang, Xiaoqun; Luo, Zhen-Ge. The hominoid-specific gene TBC1D3 promotes generation of basal neural progenitors and induces cortical folding in mice. Elife. 2016;5( 27504805) PubMed |
Velasco, Silvia; Kedaigle, Amanda J; Simmons, Sean K; Nash, Allison; Rocha, Marina; Quadrato, Giorgia; Paulsen, Bruna; Nguyen, Lan; Adiconis, Xian; Regev, Aviv; Levin, Joshua Z; Arlotta, Paola. Individual brain organoids reproducibly form cell diversity of the human cerebral cortex. Nature. 2019;570(7762):523-527. PubMed |
Bendriem, Raphael M; Singh, Shawn; Aleem, Alice Abdel; Antonetti, David A; Ross, M Elizabeth. Tight junction protein occludin regulates progenitor Self-Renewal and survival in developing cortex. Elife. 2019;8( 31794381) PubMed |
Shao, Wei; Yang, Jiajun; He, Ming; Yu, Xiang-Yu; Lee, Choong Heon; Yang, Zhaohui; Joyner, Alexandra L; Anderson, Kathryn V; Zhang, Jiangyang; Tsou, Meng-Fu Bryan; Shi, Hang; Shi, Song-Hai. Centrosome anchoring regulates progenitor properties and cortical formation. Nature. 2020;580(7801):106-112. PubMed |
Matsumoto, Naoyuki; Tanaka, Satoshi; Horiike, Toshihide; Shinmyo, Yohei; Kawasaki, Hiroshi. A discrete subtype of neural progenitor crucial for cortical folding in the gyrencephalic mammalian brain. Elife. 2020;9( 32312384) PubMed |
Hou, Qiong-Qiong; Xiao, Qi; Sun, Xin-Yao; Ju, Xiang-Chun; Luo, Zhen-Ge. TBC1D3 promotes neural progenitor proliferation by suppressing the histone methyltransferase G9a. Science Advances. 2021;7(3) PubMed |
Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995. PubMed |
Fischer, Jan; Fernández Ortuño, Eduardo; Marsoner, Fabio; Artioli, Annasara; Peters, Jula; Namba, Takashi; Eugster Oegema, Christina; Huttner, Wieland B; Ladewig, Julia; Heide, Michael. Human-specific ARHGAP11B ensures human-like basal progenitor levels in hominid cerebral organoids. Embo Reports. 2022;23(11):e54728. PubMed |
Jones, Matthew R; Lingampally, Arun; Ahmadvand, Negah; Chong, Lei; Wu, Jin; Wilhem, Jochen; Vazquez-Armendariz, Ana Ivonne; Ansari, Meshal; Herold, Susanne; Ornitz, David M; Schiller, Herbert B; Chao, Cho-Ming; Zhang, Jin-San; Carraro, Gianni; Bellusci, Saverio. FGFR2b signalling restricts lineage-flexible alveolar progenitors during mouse lung development and converges in mature alveolar type 2 cells. Cellular And Molecular Life Sciences : Cmls. 2022;79(12):609. PubMed |
Liu, Yubing; Bilen, Maria; McNicoll, Marie-Michelle; Harris, Richard A; Fong, Bensun C; Iqbal, Mohamed Ariff; Paul, Smitha; Mayne, Janice; Walker, Krystal; Wang, Jing; Figeys, Daniel; Slack, Ruth S. Early postnatal defects in neurogenesis in the 3xTg mouse model of Alzheimer's disease. Cell Death & Disease. 2023;14(2):138. PubMed |