Anti HOOK2 pAb (ATL-HPA043519)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043519-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HOOK2
Alternative Gene Name: HK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052566: 78%, ENSRNOG00000003682: 78%
Entrez Gene ID: 29911
Uniprot ID: Q96ED9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEPPTDSSTARRIEELQHNLQKKDADLRAMEERYRRYVDKARMVMQTMEPKQRPAAGAPPELHSLRTQLRERDVRIRHLEMDFEKSRSQREQEEKLLIS |
Gene Sequence | LEPPTDSSTARRIEELQHNLQKKDADLRAMEERYRRYVDKARMVMQTMEPKQRPAAGAPPELHSLRTQLRERDVRIRHLEMDFEKSRSQREQEEKLLIS |
Gene ID - Mouse | ENSMUSG00000052566 |
Gene ID - Rat | ENSRNOG00000003682 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HOOK2 pAb (ATL-HPA043519) | |
Datasheet | Anti HOOK2 pAb (ATL-HPA043519) Datasheet (External Link) |
Vendor Page | Anti HOOK2 pAb (ATL-HPA043519) at Atlas Antibodies |
Documents & Links for Anti HOOK2 pAb (ATL-HPA043519) | |
Datasheet | Anti HOOK2 pAb (ATL-HPA043519) Datasheet (External Link) |
Vendor Page | Anti HOOK2 pAb (ATL-HPA043519) |