Anti HOOK2 pAb (ATL-HPA043519)

Atlas Antibodies

Catalog No.: ATL-HPA043519-25

Protein Description: hook microtubule-tethering protein 2
Gene Name: HOOK2
Alternative Gene Name: HK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052566: 78%, ENSRNOG00000003682: 78%
Entrez Gene ID: 29911
Uniprot ID: Q96ED9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEPPTDSSTARRIEELQHNLQKKDADLRAMEERYRRYVDKARMVMQTMEPKQRPAAGAPPELHSLRTQLRERDVRIRHLEMDFEKSRSQREQEEKLLIS
• Gene Sequence: LEPPTDSSTARRIEELQHNLQKKDADLRAMEERYRRYVDKARMVMQTMEPKQRPAAGAPPELHSLRTQLRERDVRIRHLEMDFEKSRSQREQEEKLLIS
• Gene ID - Mouse: ENSMUSG00000052566
• Gene ID - Rat: ENSRNOG00000003682
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.