Anti HOOK1 pAb (ATL-HPA018820 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018820-100

Protein Description: hook microtubule-tethering protein 1
Gene Name: HOOK1
Alternative Gene Name: HK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028572: 94%, ENSRNOG00000026226: 93%
Entrez Gene ID: 51361
Uniprot ID: Q9UJC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFEMKRLEEKHEALLKEKERLIEQRDTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIEELQE
• Gene Sequence: AFEMKRLEEKHEALLKEKERLIEQRDTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIEELQE
• Gene ID - Mouse: ENSMUSG00000028572
• Gene ID - Rat: ENSRNOG00000026226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.