Anti HOOK1 pAb (ATL-HPA018537 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018537-25

Protein Description: hook microtubule-tethering protein 1
Gene Name: HOOK1
Alternative Gene Name: HK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028572: 94%, ENSRNOG00000026226: 94%
Entrez Gene ID: 51361
Uniprot ID: Q9UJC3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRALEELQEALAEKEELRQRCEELDMQVTTLQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHC
• Gene Sequence: KRALEELQEALAEKEELRQRCEELDMQVTTLQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHAQLQLEQLQEENFRLEAAKDDYRVHC
• Gene ID - Mouse: ENSMUSG00000028572
• Gene ID - Rat: ENSRNOG00000026226
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HOOK1 pAb (ATL-HPA018537 w/enhanced validation) – 2 Found

Cadalbert, Laurence C; Ghaffar, Farah Naz; Stevenson, David; Bryson, Sheila; Vaz, Frédéric M; Gottlieb, Eyal; Strathdee, Douglas. Mouse Tafazzin Is Required for Male Germ Cell Meiosis and Spermatogenesis. Plos One. 10(6):e0131066. 

Xie, Jun-Chao; Ma, Xiao-Ye; Liu, Xiao-Hui; Yu, Jia; Zhao, Yi-Chen; Tan, Yan; Liu, Xue-Yuan; Zhao, Yan-Xin. Hypoxia increases amyloid-β level in exosomes by enhancing the interaction between CD147 and Hook1. American Journal Of Translational Research. 10(1):150-163.