Anti HNRNPF pAb (ATL-HPA069667)

Atlas Antibodies

SKU:
ATL-HPA069667-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: heterogeneous nuclear ribonucleoprotein F
Gene Name: HNRNPF
Alternative Gene Name: HNRPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042079: 94%, ENSRNOG00000014562: 94%
Entrez Gene ID: 3185
Uniprot ID: P52597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS
Gene Sequence TARRYIGIVKQAGLERMRPGAYSTGYGGYEEYSGLSDGYGFTTDLFGRDLS
Gene ID - Mouse ENSMUSG00000042079
Gene ID - Rat ENSRNOG00000014562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HNRNPF pAb (ATL-HPA069667)
Datasheet Anti HNRNPF pAb (ATL-HPA069667) Datasheet (External Link)
Vendor Page Anti HNRNPF pAb (ATL-HPA069667) at Atlas Antibodies

Documents & Links for Anti HNRNPF pAb (ATL-HPA069667)
Datasheet Anti HNRNPF pAb (ATL-HPA069667) Datasheet (External Link)
Vendor Page Anti HNRNPF pAb (ATL-HPA069667)