Anti HNRNPDL pAb (ATL-HPA063147)

Atlas Antibodies

Catalog No.:
ATL-HPA063147-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: heterogeneous nuclear ribonucleoprotein D-like
Gene Name: HNRNPDL
Alternative Gene Name: HNRPDL, JKTBP, laAUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029328: 100%, ENSRNOG00000002270: 100%
Entrez Gene ID: 9987
Uniprot ID: O14979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSA
Gene Sequence HVTAQQPSRLAGGAAIKGGRRRRPDLFRRHFKSSSIQRSA
Gene ID - Mouse ENSMUSG00000029328
Gene ID - Rat ENSRNOG00000002270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HNRNPDL pAb (ATL-HPA063147)
Datasheet Anti HNRNPDL pAb (ATL-HPA063147) Datasheet (External Link)
Vendor Page Anti HNRNPDL pAb (ATL-HPA063147) at Atlas Antibodies

Documents & Links for Anti HNRNPDL pAb (ATL-HPA063147)
Datasheet Anti HNRNPDL pAb (ATL-HPA063147) Datasheet (External Link)
Vendor Page Anti HNRNPDL pAb (ATL-HPA063147)
Citations for Anti HNRNPDL pAb (ATL-HPA063147) – 1 Found
Zhang, Qingyang; Zhang, Juan; Ye, Jin; Li, Xiaohui; Liu, Hongda; Ma, Xiaolin; Wang, Chao; He, Keqiang; Zhang, Wei; Yuan, Ji; Zhao, Yingjun; Xu, Huaxi; Liu, Qiang. Nuclear speckle specific hnRNP D-like prevents age- and AD-related cognitive decline by modulating RNA splicing. Molecular Neurodegeneration. 2021;16(1):66.  PubMed