Anti HNRNPDL pAb (ATL-HPA056820)

Atlas Antibodies

Catalog No.:
ATL-HPA056820-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: heterogeneous nuclear ribonucleoprotein D-like
Gene Name: HNRNPDL
Alternative Gene Name: HNRPDL, JKTBP, laAUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029328: 94%, ENSRNOG00000002270: 94%
Entrez Gene ID: 9987
Uniprot ID: O14979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKM
Gene Sequence DSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKM
Gene ID - Mouse ENSMUSG00000029328
Gene ID - Rat ENSRNOG00000002270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HNRNPDL pAb (ATL-HPA056820)
Datasheet Anti HNRNPDL pAb (ATL-HPA056820) Datasheet (External Link)
Vendor Page Anti HNRNPDL pAb (ATL-HPA056820) at Atlas Antibodies

Documents & Links for Anti HNRNPDL pAb (ATL-HPA056820)
Datasheet Anti HNRNPDL pAb (ATL-HPA056820) Datasheet (External Link)
Vendor Page Anti HNRNPDL pAb (ATL-HPA056820)
Citations for Anti HNRNPDL pAb (ATL-HPA056820) – 1 Found
Garcia-Pardo, Javier; Bartolomé-Nafría, Andrea; Chaves-Sanjuan, Antonio; Gil-Garcia, Marcos; Visentin, Cristina; Bolognesi, Martino; Ricagno, Stefano; Ventura, Salvador. Cryo-EM structure of hnRNPDL-2 fibrils, a functional amyloid associated with limb-girdle muscular dystrophy D3. Nature Communications. 2023;14(1):239.  PubMed