Anti HNRNPDL pAb (ATL-HPA056820)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056820-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HNRNPDL
Alternative Gene Name: HNRPDL, JKTBP, laAUF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029328: 94%, ENSRNOG00000002270: 94%
Entrez Gene ID: 9987
Uniprot ID: O14979
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKM |
| Gene Sequence | DSSVTMEDMNEYSNIEEFAEGSKINASKNQQDDGKM |
| Gene ID - Mouse | ENSMUSG00000029328 |
| Gene ID - Rat | ENSRNOG00000002270 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HNRNPDL pAb (ATL-HPA056820) | |
| Datasheet | Anti HNRNPDL pAb (ATL-HPA056820) Datasheet (External Link) |
| Vendor Page | Anti HNRNPDL pAb (ATL-HPA056820) at Atlas Antibodies |
| Documents & Links for Anti HNRNPDL pAb (ATL-HPA056820) | |
| Datasheet | Anti HNRNPDL pAb (ATL-HPA056820) Datasheet (External Link) |
| Vendor Page | Anti HNRNPDL pAb (ATL-HPA056820) |
| Citations for Anti HNRNPDL pAb (ATL-HPA056820) – 1 Found |
| Garcia-Pardo, Javier; Bartolomé-Nafría, Andrea; Chaves-Sanjuan, Antonio; Gil-Garcia, Marcos; Visentin, Cristina; Bolognesi, Martino; Ricagno, Stefano; Ventura, Salvador. Cryo-EM structure of hnRNPDL-2 fibrils, a functional amyloid associated with limb-girdle muscular dystrophy D3. Nature Communications. 2023;14(1):239. PubMed |