Anti HNRNPA3 pAb (ATL-HPA066381)

Atlas Antibodies

Catalog No.: ATL-HPA066381-25

Protein Description: heterogeneous nuclear ribonucleoprotein A3
Gene Name: HNRNPA3
Alternative Gene Name: HNRPA3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059005: 100%, ENSRNOG00000052968: 100%
Entrez Gene ID: 220988
Uniprot ID: P51991
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQL
• Gene Sequence: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQL
• Gene ID - Mouse: ENSMUSG00000059005
• Gene ID - Rat: ENSRNOG00000052968
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.