Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002083-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HNF1B
Alternative Gene Name: HNF1beta, LFB3, MODY5, TCF2, VHNF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020679: 97%, ENSRNOG00000002598: 97%
Entrez Gene ID: 6928
Uniprot ID: P35680
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH |
| Gene Sequence | KEVLVQALEELLPSPNFGVKLETLPLSPGSGAEPDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQH |
| Gene ID - Mouse | ENSMUSG00000020679 |
| Gene ID - Rat | ENSRNOG00000002598 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation) | |
| Datasheet | Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation) | |
| Datasheet | Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation) |
| Citations for Anti HNF1B pAb (ATL-HPA002083 w/enhanced validation) – 19 Found |
| Köbel, Martin; Meng, Bo; Hoang, Lien N; Almadani, Noorah; Li, Xiaodong; Soslow, Robert A; Gilks, C Blake; Lee, Cheng-Han. Molecular Analysis of Mixed Endometrial Carcinomas Shows Clonality in Most Cases. The American Journal Of Surgical Pathology. 2016;40(2):166-180. PubMed |
| Diaferia, Giuseppe R; Balestrieri, Chiara; Prosperini, Elena; Nicoli, Paola; Spaggiari, Paola; Zerbi, Alessandro; Natoli, Gioacchino. Dissection of transcriptional and cis-regulatory control of differentiation in human pancreatic cancer. The Embo Journal. 2016;35(6):595-617. PubMed |
| Janky, Rekin's; Binda, Maria Mercedes; Allemeersch, Joke; Van den Broeck, Anke; Govaere, Olivier; Swinnen, Johannes V; Roskams, Tania; Aerts, Stein; Topal, Baki. Prognostic relevance of molecular subtypes and master regulators in pancreatic ductal adenocarcinoma. Bmc Cancer. 2016;16( 27520560):632. PubMed |
| Naylor, Richard W; Dodd, Rachel C; Davidson, Alan J. Caudal migration and proliferation of renal progenitors regulates early nephron segment size in zebrafish. Scientific Reports. 2016;6( 27759103):35647. PubMed |
| Franklin, Miriam; Gentles, Lucy; Matheson, Elizabeth; Bown, Nick; Cross, Paul; Ralte, Angela; Gilkes-Immeson, Connor; Bradbury, Alice; Zanjirband, Maryam; Lunec, John; Drew, Yvette; O'Donnell, Rachel; Curtin, Nicola J. Characterization and drug sensitivity of a novel human ovarian clear cell carcinoma cell line genomically and phenotypically similar to the original tumor. Cancer Medicine. 2018;7(9):4744-4754. PubMed |
| Silva, Fernanda; Coelho, Filipa; Peixoto, Ana; Pinto, Pedro; Martins, Carmo; Frombach, Ann-Sophie; Santo, Vítor E; Brito, Catarina; Guimarães, António; Félix, Ana. Establishment and characterization of a novel ovarian high-grade serous carcinoma cell line-IPO43. Cancer Cell International. 2022;22(1):175. PubMed |
| Szponar, Adrianna; Yusenko, Maria V; Kuiper, Roland; van Kessel, Ad Geurts; Kovacs, Gyula. Genomic profiling of papillary renal cell tumours identifies small regions of DNA alterations: a possible role of HNF1B in tumour development. Histopathology. 2011;58(6):934-43. PubMed |
| Donthamsetty, Shashikiran; Bhave, Vishakha S; Mars, Wendy M; Bowen, William C; Orr, Anne; Haynes, Meagan M; Wu, Chuanyue; Michalopoulos, George K. Role of PINCH and its partner tumor suppressor Rsu-1 in regulating liver size and tumorigenesis. Plos One. 8(9):e74625. PubMed |
| Davidson, Ben. Hepatocyte nuclear factor-1β is not a specific marker of clear cell carcinoma in serous effusions. Cancer Cytopathology. 2014;122(2):153-8. PubMed |
| Goyeneche, Alicia A; Koch, Michael; Bell, Maria C; Telleria, Carlos M. Long-term primary culture of a clear cell ovarian carcinoma reveals an epithelial-mesenchymal cooperative interaction. Cancer Cell International. 15( 26405433):88. PubMed |
| Omata, Mitsugu; Doke, Yukiko; Yamada, Chikaomi; Kawashima, Kayoko; Sho, Rumiko; Enomoto, Kei; Furuya, Mayumi; Inomata, Norio. Hepatocyte Nuclear Factor-1β Induces Redifferentiation of Dedifferentiated Tubular Epithelial Cells. Plos One. 11(5):e0154912. PubMed |
| Yang, Michelle X; Coates, Ryan F; Ambaye, Abiy; Gardner, Juli-Anne; Zubarick, Richard; Gao, Yuan; Skelly, Joan; Liu, James G; Mino-Kenudson, Mari. Investigation of HNF-1B as a diagnostic biomarker for pancreatic ductal adenocarcinoma. Biomarker Research. 6( 30065837):25. PubMed |
| Ida, Hideomi; Akiyama, Tomohiko; Ishiguro, Keiichiro; Goparaju, Sravan K; Nakatake, Yuhki; Chikazawa-Nohtomi, Nana; Sato, Saeko; Kimura, Hiromi; Yokoyama, Yukihiro; Nagino, Masato; Ko, Minoru S H; Ko, Shigeru B H. Establishment of a rapid and footprint-free protocol for differentiation of human embryonic stem cells into pancreatic endocrine cells with synthetic mRNAs encoding transcription factors. Stem Cell Research & Therapy. 2018;9(1):277. PubMed |
| Pors, Jennifer; Segura, Sheila; Cheng, Angela; Ji, Jennifer X; Tessier-Cloutier, Basile; Cochrane, Dawn; Fix, Daniel J; Park, Kay; Gilks, Blake; Hoang, Lynn. Napsin-A and AMACR are Superior to HNF-1β in Distinguishing Between Mesonephric Carcinomas and Clear Cell Carcinomas of the Gynecologic Tract. Applied Immunohistochemistry & Molecular Morphology : Aimm. 2020;28(8):593-601. PubMed |
| Milan, Marta; Balestrieri, Chiara; Alfarano, Gabriele; Polletti, Sara; Prosperini, Elena; Spaggiari, Paola; Zerbi, Alessandro; Diaferia, Giuseppe R; Natoli, Gioacchino. FOXA2 controls the cis-regulatory networks of pancreatic cancer cells in a differentiation grade-specific manner. The Embo Journal. 2019;38(20):e102161. PubMed |
| Bártů, Michaela; Hojný, Jan; Hájková, Nikola; Michálková, Romana; Krkavcová, Eva; Hadravský, Ladislav; Kleissnerová, Lenka; Bui, Quang Hiep; Stružinská, Ivana; Němejcová, Kristýna; Čapoun, Otakar; Šlemendová, Monika; Dundr, Pavel. Analysis of expression, epigenetic, and genetic changes of HNF1B in 130 kidney tumours. Scientific Reports. 2020;10(1):17151. PubMed |
| Watkins, Jaclyn C; Downing, Michael J; Crous-Bou, Marta; Busch, Evan L; Chen, Maxine; De Vivo, Immaculata; Mutter, George L. Endometrial Tumor Classification by Histomorphology and Biomarkers in the Nurses' Health Study. Journal Of Cancer Epidemiology. 2021( 33986807):8884364. PubMed |
| Sander, Veronika; Przepiorski, Aneta; Crunk, Amanda E; Hukriede, Neil A; Holm, Teresa M; Davidson, Alan J. Protocol for Large-Scale Production of Kidney Organoids from Human Pluripotent Stem Cells. Star Protocols. 2020;1(3):100150. PubMed |
| Dhara, S; Chhangawala, S; Chintalapudi, H; Askan, G; Aveson, V; Massa, A L; Zhang, L; Torres, D; Makohon-Moore, A P; Lecomte, N; Melchor, J P; Bermeo, J; Cardenas, A 3rd; Sinha, S; Glassman, D; Nicolle, R; Moffitt, R; Yu, K H; Leppanen, S; Laderman, S; Curry, B; Gui, J; Balachandran, V P; Iacobuzio-Donahue, C; Chandwani, R; Leslie, C S; Leach, S D. Pancreatic cancer prognosis is predicted by an ATAC-array technology for assessing chromatin accessibility. Nature Communications. 2021;12(1):3044. PubMed |