Anti HN1 pAb (ATL-HPA059729 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA059729-100

Protein Description: hematological and neurological expressed 1
Gene Name: HN1
Alternative Gene Name: ARM2, HN1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020737: 95%, ENSRNOG00000003661: 97%
Entrez Gene ID: 51155
Uniprot ID: Q9UK76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS
• Gene Sequence: MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS
• Gene ID - Mouse: ENSMUSG00000020737
• Gene ID - Rat: ENSRNOG00000003661
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HN1 pAb (ATL-HPA059729 w/enhanced validation) – 2 Found

Zhang, Chen; Xu, Bingfei; Lu, Shi; Zhao, Ying; Liu, Pian. HN1 contributes to migration, invasion, and tumorigenesis of breast cancer by enhancing MYC activity. Molecular Cancer. 2017;16(1):90. 

Bateman, Nicholas W; Teng, Pang-Ning; Hope, Erica; Hood, Brian L; Oliver, Julie; Ao, Wei; Zhou, Ming; Wang, Guisong; Tommarello, Domenic; Wilson, Katlin; Litzy, Tracy; Conrads, Kelly A; Hamilton, Chad A; Darcy, Kathleen M; Casablanca, Yovanni; Maxwell, George Larry; Bae-Jump, Victoria; Conrads, Thomas P. Jupiter microtubule-associated homolog 1 (JPT1): A predictive and pharmacodynamic biomarker of metformin response in endometrial cancers. Cancer Medicine. 2020;9(3):1092-1103.