Anti HMX3 pAb (ATL-HPA069659)

Atlas Antibodies

Catalog No.:
ATL-HPA069659-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: H6 family homeobox 3
Gene Name: HMX3
Alternative Gene Name: NKX5-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040148: 100%, ENSRNOG00000020637: 100%
Entrez Gene ID: 340784
Uniprot ID: A6NHT5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTP
Gene Sequence GFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTP
Gene ID - Mouse ENSMUSG00000040148
Gene ID - Rat ENSRNOG00000020637
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HMX3 pAb (ATL-HPA069659)
Datasheet Anti HMX3 pAb (ATL-HPA069659) Datasheet (External Link)
Vendor Page Anti HMX3 pAb (ATL-HPA069659) at Atlas Antibodies

Documents & Links for Anti HMX3 pAb (ATL-HPA069659)
Datasheet Anti HMX3 pAb (ATL-HPA069659) Datasheet (External Link)
Vendor Page Anti HMX3 pAb (ATL-HPA069659)