Anti HMGXB4 pAb (ATL-HPA076681)

Atlas Antibodies

Catalog No.:
ATL-HPA076681-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: HMG-box containing 4
Gene Name: HMGXB4
Alternative Gene Name: HMG2L1, THC211630
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034518: 98%, ENSRNOG00000013878: 96%
Entrez Gene ID: 10042
Uniprot ID: Q9UGU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPT
Gene Sequence YQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPT
Gene ID - Mouse ENSMUSG00000034518
Gene ID - Rat ENSRNOG00000013878
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HMGXB4 pAb (ATL-HPA076681)
Datasheet Anti HMGXB4 pAb (ATL-HPA076681) Datasheet (External Link)
Vendor Page Anti HMGXB4 pAb (ATL-HPA076681) at Atlas Antibodies

Documents & Links for Anti HMGXB4 pAb (ATL-HPA076681)
Datasheet Anti HMGXB4 pAb (ATL-HPA076681) Datasheet (External Link)
Vendor Page Anti HMGXB4 pAb (ATL-HPA076681)