Anti HMGCR pAb (ATL-HPA008338)

Atlas Antibodies

Catalog No.:
ATL-HPA008338-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: 3-hydroxy-3-methylglutaryl-CoA reductase
Gene Name: HMGCR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021670: 99%, ENSRNOG00000016122: 99%
Entrez Gene ID: 3156
Uniprot ID: P04035
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG
Gene Sequence MAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQG
Gene ID - Mouse ENSMUSG00000021670
Gene ID - Rat ENSRNOG00000016122
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HMGCR pAb (ATL-HPA008338)
Datasheet Anti HMGCR pAb (ATL-HPA008338) Datasheet (External Link)
Vendor Page Anti HMGCR pAb (ATL-HPA008338) at Atlas Antibodies

Documents & Links for Anti HMGCR pAb (ATL-HPA008338)
Datasheet Anti HMGCR pAb (ATL-HPA008338) Datasheet (External Link)
Vendor Page Anti HMGCR pAb (ATL-HPA008338)
Citations for Anti HMGCR pAb (ATL-HPA008338) – 10 Found
Kimbung, Siker; Lettiero, Barbara; Feldt, Maria; Bosch, Ana; Borgquist, Signe. High expression of cholesterol biosynthesis genes is associated with resistance to statin treatment and inferior survival in breast cancer. Oncotarget. 2016;7(37):59640-59651.  PubMed
Gray, Ronan T; Loughrey, Maurice B; Bankhead, Peter; Cardwell, Chris R; McQuaid, Stephen; O'Neill, Roisin F; Arthur, Kenneth; Bingham, Victoria; McGready, Claire; Gavin, Anna T; James, Jacqueline A; Hamilton, Peter W; Salto-Tellez, Manuel; Murray, Liam J; Coleman, Helen G. Statin use, candidate mevalonate pathway biomarkers, and colon cancer survival in a population-based cohort study. British Journal Of Cancer. 2017;116(12):1652-1659.  PubMed
Deng, Yue-Zhen; Cai, Zhen; Shi, Shuo; Jiang, Hao; Shang, Yu-Rong; Ma, Ning; Wang, Jing-Jing; Guan, Dong-Xian; Chen, Tian-Wei; Rong, Ye-Fei; Qian, Zhen-Yu; Zhang, Er-Bin; Feng, Dan; Zhou, Quan-Li; Du, Yi-Nan; Liu, Dong-Ping; Huang, Xing-Xu; Liu, Lu-Ming; Chin, Eugene; Li, Dang-Sheng; Wang, Xiao-Fan; Zhang, Xue-Li; Xie, Dong. Cilia loss sensitizes cells to transformation by activating the mevalonate pathway. The Journal Of Experimental Medicine. 2018;215(1):177-195.  PubMed
Tryggvadottir, Helga; Huzell, Louise; Gustbée, Emma; Simonsson, Maria; Markkula, Andrea; Jirström, Karin; Rose, Carsten; Ingvar, Christian; Borgquist, Signe; Jernström, Helena. Interactions Between ABCB1 Genotype and Preoperative Statin Use Impact Clinical Outcomes Among Breast Cancer Patients. Frontiers In Oncology. 8( 30370250):428.  PubMed
Bjarnadottir, Olöf; Romero, Quinci; Bendahl, Pär-Ola; Jirström, Karin; Rydén, Lisa; Loman, Niklas; Uhlén, Mathias; Johannesson, Henrik; Rose, Carsten; Grabau, Dorthe; Borgquist, Signe. Targeting HMG-CoA reductase with statins in a window-of-opportunity breast cancer trial. Breast Cancer Research And Treatment. 2013;138(2):499-508.  PubMed
Bengtsson, Erik; Nerjovaj, Pashtrik; Wangefjord, Sakarias; Nodin, Björn; Eberhard, Jakob; Uhlén, Mathias; Borgquist, Signe; Jirström, Karin. HMG-CoA reductase expression in primary colorectal cancer correlates with favourable clinicopathological characteristics and an improved clinical outcome. Diagnostic Pathology. 2014;9( 24708688):78.  PubMed
Gustbée, Emma; Tryggvadottir, Helga; Markkula, Andrea; Simonsson, Maria; Nodin, Björn; Jirström, Karin; Rose, Carsten; Ingvar, Christian; Borgquist, Signe; Jernström, Helena. Tumor-specific expression of HMG-CoA reductase in a population-based cohort of breast cancer patients. Bmc Clinical Pathology. 15( 26109908):8.  PubMed
Di Benedetto, Anna; Mottolese, Marcella; Sperati, Francesca; Ercolani, Cristiana; Di Lauro, Luigi; Pizzuti, Laura; Vici, Patrizia; Terrenato, Irene; Shaaban, Abeer M; Sundara-Rajan, Sreekumar; Humphries, Matthew P; Barba, Maddalena; Speirs, Valerie; De Maria, Ruggero; Maugeri-Saccà, Marcello. HMG-CoAR expression in male breast cancer: relationship with hormone receptors, Hippo transducers and survival outcomes. Scientific Reports. 2016;6( 27713571):35121.  PubMed
Zhong, Chenxi; Fan, Limin; Li, Zhigang; Yao, Feng; Zhao, Heng. SREBP2 is upregulated in esophageal squamous cell carcinoma and co‑operates with c‑Myc to regulate HMGCR expression. Molecular Medicine Reports. 2019;20(4):3003-3010.  PubMed
Wei, Shupei; Liu, Lili; Chen, Zhiyu; Yin, Wenli; Liu, Yingzi; Ouyang, Qianying; Zeng, Feiyue; Nie, Yingjie; Chen, Tao. Artesunate inhibits the mevalonate pathway and promotes glioma cell senescence. Journal Of Cellular And Molecular Medicine. 2020;24(1):276-284.  PubMed