Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035699-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HMGB4
Alternative Gene Name: FLJ40388
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048686: 68%, ENSRNOG00000032889: 63%
Entrez Gene ID: 127540
Uniprot ID: Q8WW32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMS |
| Gene Sequence | PPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMS |
| Gene ID - Mouse | ENSMUSG00000048686 |
| Gene ID - Rat | ENSRNOG00000032889 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation) | |
| Datasheet | Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation) | |
| Datasheet | Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation) |
| Citations for Anti HMGB4 pAb (ATL-HPA035699 w/enhanced validation) – 1 Found |
| Fagerberg, Linn; Hallström, Björn M; Oksvold, Per; Kampf, Caroline; Djureinovic, Dijana; Odeberg, Jacob; Habuka, Masato; Tahmasebpoor, Simin; Danielsson, Angelika; Edlund, Karolina; Asplund, Anna; Sjöstedt, Evelina; Lundberg, Emma; Szigyarto, Cristina Al-Khalili; Skogs, Marie; Takanen, Jenny Ottosson; Berling, Holger; Tegel, Hanna; Mulder, Jan; Nilsson, Peter; Schwenk, Jochen M; Lindskog, Cecilia; Danielsson, Frida; Mardinoglu, Adil; Sivertsson, Asa; von Feilitzen, Kalle; Forsberg, Mattias; Zwahlen, Martin; Olsson, IngMarie; Navani, Sanjay; Huss, Mikael; Nielsen, Jens; Ponten, Fredrik; Uhlén, Mathias. Analysis of the human tissue-specific expression by genome-wide integration of transcriptomics and antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2014;13(2):397-406. PubMed |