Anti HMG20B pAb (ATL-HPA069832)

Atlas Antibodies

SKU: ATL-HPA069832-25

• 

Protein Description: high mobility group 20B
Gene Name: HMG20B
Alternative Gene Name: BRAF25, BRAF35, HMGX2, HMGXB2, SMARCE1r, SOXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020232: 89%, ENSRNOG00000020601: 91%
Entrez Gene ID: 10362
Uniprot ID: Q9P0W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV
• Gene Sequence: GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV
• Gene ID - Mouse: ENSMUSG00000020232
• Gene ID - Rat: ENSRNOG00000020601
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.