Anti HMG20B pAb (ATL-HPA069832)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069832-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HMG20B
Alternative Gene Name: BRAF25, BRAF35, HMGX2, HMGXB2, SMARCE1r, SOXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020232: 89%, ENSRNOG00000020601: 91%
Entrez Gene ID: 10362
Uniprot ID: Q9P0W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV |
| Gene Sequence | GFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGPKAPVTGYV |
| Gene ID - Mouse | ENSMUSG00000020232 |
| Gene ID - Rat | ENSRNOG00000020601 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HMG20B pAb (ATL-HPA069832) | |
| Datasheet | Anti HMG20B pAb (ATL-HPA069832) Datasheet (External Link) |
| Vendor Page | Anti HMG20B pAb (ATL-HPA069832) at Atlas Antibodies |
| Documents & Links for Anti HMG20B pAb (ATL-HPA069832) | |
| Datasheet | Anti HMG20B pAb (ATL-HPA069832) Datasheet (External Link) |
| Vendor Page | Anti HMG20B pAb (ATL-HPA069832) |