Anti HMG20B pAb (ATL-HPA053157)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053157-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HMG20B
Alternative Gene Name: BRAF25, BRAF35, HMGX2, HMGXB2, SMARCE1r, SOXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020232: 90%, ENSRNOG00000020601: 89%
Entrez Gene ID: 10362
Uniprot ID: Q9P0W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | REKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVP |
Gene Sequence | REKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVP |
Gene ID - Mouse | ENSMUSG00000020232 |
Gene ID - Rat | ENSRNOG00000020601 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HMG20B pAb (ATL-HPA053157) | |
Datasheet | Anti HMG20B pAb (ATL-HPA053157) Datasheet (External Link) |
Vendor Page | Anti HMG20B pAb (ATL-HPA053157) at Atlas Antibodies |
Documents & Links for Anti HMG20B pAb (ATL-HPA053157) | |
Datasheet | Anti HMG20B pAb (ATL-HPA053157) Datasheet (External Link) |
Vendor Page | Anti HMG20B pAb (ATL-HPA053157) |