Anti HMCN2 pAb (ATL-HPA070647)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070647-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: HMCN2
Alternative Gene Name: DKFZp434P0216, FLJ23816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055632: 75%, ENSRNOG00000019356: 36%
Entrez Gene ID: 256158
Uniprot ID: Q8NDA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTIEWLQAGQPLRASRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVRGEPQGSWGSMTGVINGRK |
| Gene Sequence | PTIEWLQAGQPLRASRRLRTLPDGSLWLENVETGDAGTYDCVAHNLLGSATARAFLVVRGEPQGSWGSMTGVINGRK |
| Gene ID - Mouse | ENSMUSG00000055632 |
| Gene ID - Rat | ENSRNOG00000019356 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HMCN2 pAb (ATL-HPA070647) | |
| Datasheet | Anti HMCN2 pAb (ATL-HPA070647) Datasheet (External Link) |
| Vendor Page | Anti HMCN2 pAb (ATL-HPA070647) at Atlas Antibodies |
| Documents & Links for Anti HMCN2 pAb (ATL-HPA070647) | |
| Datasheet | Anti HMCN2 pAb (ATL-HPA070647) Datasheet (External Link) |
| Vendor Page | Anti HMCN2 pAb (ATL-HPA070647) |