Anti HMBOX1 pAb (ATL-HPA055855)

Atlas Antibodies

Catalog No.:
ATL-HPA055855-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: homeobox containing 1
Gene Name: HMBOX1
Alternative Gene Name: FLJ21616, HNF1LA, HOT1, PBHNF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021972: 100%, ENSRNOG00000013326: 47%
Entrez Gene ID: 79618
Uniprot ID: Q6NT76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDD
Gene Sequence IKRRANIEAAILESHGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHTILALARQGANEIKTEALDD
Gene ID - Mouse ENSMUSG00000021972
Gene ID - Rat ENSRNOG00000013326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HMBOX1 pAb (ATL-HPA055855)
Datasheet Anti HMBOX1 pAb (ATL-HPA055855) Datasheet (External Link)
Vendor Page Anti HMBOX1 pAb (ATL-HPA055855) at Atlas Antibodies

Documents & Links for Anti HMBOX1 pAb (ATL-HPA055855)
Datasheet Anti HMBOX1 pAb (ATL-HPA055855) Datasheet (External Link)
Vendor Page Anti HMBOX1 pAb (ATL-HPA055855)