Anti HM13 pAb (ATL-HPA056062)

Atlas Antibodies

Catalog No.:
ATL-HPA056062-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: histocompatibility (minor) 13
Gene Name: HM13
Alternative Gene Name: dJ324O17.1, H13, IMP1, IMPAS, PSENL3, PSL3, SPP, SPPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019188: 88%, ENSRNOG00000007738: 90%
Entrez Gene ID: 81502
Uniprot ID: Q8TCT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK
Gene Sequence KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK
Gene ID - Mouse ENSMUSG00000019188
Gene ID - Rat ENSRNOG00000007738
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HM13 pAb (ATL-HPA056062)
Datasheet Anti HM13 pAb (ATL-HPA056062) Datasheet (External Link)
Vendor Page Anti HM13 pAb (ATL-HPA056062) at Atlas Antibodies

Documents & Links for Anti HM13 pAb (ATL-HPA056062)
Datasheet Anti HM13 pAb (ATL-HPA056062) Datasheet (External Link)
Vendor Page Anti HM13 pAb (ATL-HPA056062)