Anti HM13 pAb (ATL-HPA056062)

Atlas Antibodies

SKU: ATL-HPA056062-25

• 

Protein Description: histocompatibility (minor) 13
Gene Name: HM13
Alternative Gene Name: dJ324O17.1, H13, IMP1, IMPAS, PSENL3, PSL3, SPP, SPPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019188: 88%, ENSRNOG00000007738: 90%
Entrez Gene ID: 81502
Uniprot ID: Q8TCT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK
• Gene Sequence: KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK
• Gene ID - Mouse: ENSMUSG00000019188
• Gene ID - Rat: ENSRNOG00000007738
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.