Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053176-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: major histocompatibility complex, class II, DR alpha
Gene Name: HLA-DRA
Alternative Gene Name: HLA-DRA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024334: 41%, ENSRNOG00000032844: 83%
Entrez Gene ID: 3122
Uniprot ID: P01903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK
Gene Sequence AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK
Gene ID - Mouse ENSMUSG00000024334
Gene ID - Rat ENSRNOG00000032844
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation)
Datasheet Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation)
Datasheet Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation)
Citations for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) – 1 Found
Balakrishnan, Carol K; Tye, Gee Jun; Balasubramaniam, Shandra Devi; Kaur, Gurjeet. CD74 and HLA-DRA in Cervical Carcinogenesis: Potential Targets for Antitumour Therapy. Medicina (Kaunas, Lithuania). 2022;58(2)  PubMed