Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053176-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: HLA-DRA
Alternative Gene Name: HLA-DRA1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024334: 41%, ENSRNOG00000032844: 83%
Entrez Gene ID: 3122
Uniprot ID: P01903
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK |
Gene Sequence | AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK |
Gene ID - Mouse | ENSMUSG00000024334 |
Gene ID - Rat | ENSRNOG00000032844 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) | |
Datasheet | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) | |
Datasheet | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) |
Citations for Anti HLA-DRA pAb (ATL-HPA053176 w/enhanced validation) – 1 Found |
Balakrishnan, Carol K; Tye, Gee Jun; Balasubramaniam, Shandra Devi; Kaur, Gurjeet. CD74 and HLA-DRA in Cervical Carcinogenesis: Potential Targets for Antitumour Therapy. Medicina (Kaunas, Lithuania). 2022;58(2) PubMed |