Anti HLA-DQB1 pAb (ATL-HPA013667)

Atlas Antibodies

Catalog No.:
ATL-HPA013667-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: major histocompatibility complex, class II, DQ beta 1
Gene Name: HLA-DQB1
Alternative Gene Name: CELIAC1, HLA-DQB, IDDM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073421: 75%, ENSRNOG00000032708: 70%
Entrez Gene ID: 3119
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
Gene Sequence RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
Gene ID - Mouse ENSMUSG00000073421
Gene ID - Rat ENSRNOG00000032708
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HLA-DQB1 pAb (ATL-HPA013667)
Datasheet Anti HLA-DQB1 pAb (ATL-HPA013667) Datasheet (External Link)
Vendor Page Anti HLA-DQB1 pAb (ATL-HPA013667) at Atlas Antibodies

Documents & Links for Anti HLA-DQB1 pAb (ATL-HPA013667)
Datasheet Anti HLA-DQB1 pAb (ATL-HPA013667) Datasheet (External Link)
Vendor Page Anti HLA-DQB1 pAb (ATL-HPA013667)