Anti HLA-DQB1 pAb (ATL-HPA013667)

Atlas Antibodies

SKU: ATL-HPA013667-100

• 
• 

Protein Description: major histocompatibility complex, class II, DQ beta 1
Gene Name: HLA-DQB1
Alternative Gene Name: CELIAC1, HLA-DQB, IDDM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073421: 75%, ENSRNOG00000032708: 70%
Entrez Gene ID: 3119
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
• Gene Sequence: RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
• Gene ID - Mouse: ENSMUSG00000073421
• Gene ID - Rat: ENSRNOG00000032708
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.