Anti HLA-DMB pAb (ATL-HPA077524)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077524-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HLA-DMB
Alternative Gene Name: D6S221E, RING7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037548: 76%, ENSRNOG00000049491: 72%
Entrez Gene ID: 3109
Uniprot ID: P28068
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL |
Gene Sequence | YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL |
Gene ID - Mouse | ENSMUSG00000037548 |
Gene ID - Rat | ENSRNOG00000049491 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HLA-DMB pAb (ATL-HPA077524) | |
Datasheet | Anti HLA-DMB pAb (ATL-HPA077524) Datasheet (External Link) |
Vendor Page | Anti HLA-DMB pAb (ATL-HPA077524) at Atlas Antibodies |
Documents & Links for Anti HLA-DMB pAb (ATL-HPA077524) | |
Datasheet | Anti HLA-DMB pAb (ATL-HPA077524) Datasheet (External Link) |
Vendor Page | Anti HLA-DMB pAb (ATL-HPA077524) |