Anti HK3 pAb (ATL-HPA056743 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA056743-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: hexokinase 3 (white cell)
Gene Name: HK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025877: 69%, ENSRNOG00000026235: 67%
Entrez Gene ID: 3101
Uniprot ID: P52790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQA
Gene Sequence MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQA
Gene ID - Mouse ENSMUSG00000025877
Gene ID - Rat ENSRNOG00000026235
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HK3 pAb (ATL-HPA056743 w/enhanced validation)
Datasheet Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HK3 pAb (ATL-HPA056743 w/enhanced validation)
Datasheet Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HK3 pAb (ATL-HPA056743 w/enhanced validation)
Citations for Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) – 1 Found
Perrin-Cocon, Laure; Vidalain, Pierre-Olivier; Jacquemin, Clémence; Aublin-Gex, Anne; Olmstead, Keedrian; Panthu, Baptiste; Rautureau, Gilles Jeans Philippe; André, Patrice; Nyczka, Piotr; Hütt, Marc-Thorsten; Amoedo, Nivea; Rossignol, Rodrigue; Filipp, Fabian Volker; Lotteau, Vincent; Diaz, Olivier. A hexokinase isoenzyme switch in human liver cancer cells promotes lipogenesis and enhances innate immunity. Communications Biology. 2021;4(1):217.  PubMed