Anti HK3 pAb (ATL-HPA056743 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056743-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025877: 69%, ENSRNOG00000026235: 67%
Entrez Gene ID: 3101
Uniprot ID: P52790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQA |
| Gene Sequence | MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQA |
| Gene ID - Mouse | ENSMUSG00000025877 |
| Gene ID - Rat | ENSRNOG00000026235 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) | |
| Datasheet | Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) | |
| Datasheet | Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) |
| Citations for Anti HK3 pAb (ATL-HPA056743 w/enhanced validation) – 1 Found |
| Perrin-Cocon, Laure; Vidalain, Pierre-Olivier; Jacquemin, Clémence; Aublin-Gex, Anne; Olmstead, Keedrian; Panthu, Baptiste; Rautureau, Gilles Jeans Philippe; André, Patrice; Nyczka, Piotr; Hütt, Marc-Thorsten; Amoedo, Nivea; Rossignol, Rodrigue; Filipp, Fabian Volker; Lotteau, Vincent; Diaz, Olivier. A hexokinase isoenzyme switch in human liver cancer cells promotes lipogenesis and enhances innate immunity. Communications Biology. 2021;4(1):217. PubMed |