Anti HK2 pAb (ATL-HPA061711)

Atlas Antibodies

Catalog No.:
ATL-HPA061711-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hexokinase 2
Gene Name: HK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000628: 88%, ENSRNOG00000006116: 90%
Entrez Gene ID: 3099
Uniprot ID: P52789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPT
Gene Sequence ADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPT
Gene ID - Mouse ENSMUSG00000000628
Gene ID - Rat ENSRNOG00000006116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HK2 pAb (ATL-HPA061711)
Datasheet Anti HK2 pAb (ATL-HPA061711) Datasheet (External Link)
Vendor Page Anti HK2 pAb (ATL-HPA061711) at Atlas Antibodies

Documents & Links for Anti HK2 pAb (ATL-HPA061711)
Datasheet Anti HK2 pAb (ATL-HPA061711) Datasheet (External Link)
Vendor Page Anti HK2 pAb (ATL-HPA061711)