Anti HK2 pAb (ATL-HPA028587 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028587-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: hexokinase 2
Gene Name: HK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000628: 81%, ENSRNOG00000006116: 82%
Entrez Gene ID: 3099
Uniprot ID: P52789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSA
Gene Sequence GKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSA
Gene ID - Mouse ENSMUSG00000000628
Gene ID - Rat ENSRNOG00000006116
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HK2 pAb (ATL-HPA028587 w/enhanced validation)
Datasheet Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HK2 pAb (ATL-HPA028587 w/enhanced validation)
Datasheet Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HK2 pAb (ATL-HPA028587 w/enhanced validation)
Citations for Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) – 1 Found
Hagiwara, Akifumi; Yao, Jingwen; Raymond, Catalina; Cho, Nicholas S; Everson, Richard; Patel, Kunal; Morrow, Danielle H; Desousa, Brandon R; Mareninov, Sergey; Chun, Saewon; Nathanson, David A; Yong, William H; Andrei, Gafita; Divakaruni, Ajit S; Salamon, Noriko; Pope, Whitney B; Nghiemphu, Phioanh L; Liau, Linda M; Cloughesy, Timothy F; Ellingson, Benjamin M. "Aerobic glycolytic imaging" of human gliomas using combined pH-, oxygen-, and perfusion-weighted magnetic resonance imaging. Neuroimage. Clinical. 32( 34911188):102882.  PubMed