Anti HK2 pAb (ATL-HPA028587 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028587-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000628: 81%, ENSRNOG00000006116: 82%
Entrez Gene ID: 3099
Uniprot ID: P52789
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSA |
Gene Sequence | GKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQEDCVATHRICQIVSTRSA |
Gene ID - Mouse | ENSMUSG00000000628 |
Gene ID - Rat | ENSRNOG00000006116 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) | |
Datasheet | Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) | |
Datasheet | Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) |
Citations for Anti HK2 pAb (ATL-HPA028587 w/enhanced validation) – 1 Found |
Hagiwara, Akifumi; Yao, Jingwen; Raymond, Catalina; Cho, Nicholas S; Everson, Richard; Patel, Kunal; Morrow, Danielle H; Desousa, Brandon R; Mareninov, Sergey; Chun, Saewon; Nathanson, David A; Yong, William H; Andrei, Gafita; Divakaruni, Ajit S; Salamon, Noriko; Pope, Whitney B; Nghiemphu, Phioanh L; Liau, Linda M; Cloughesy, Timothy F; Ellingson, Benjamin M. "Aerobic glycolytic imaging" of human gliomas using combined pH-, oxygen-, and perfusion-weighted magnetic resonance imaging. Neuroimage. Clinical. 32( 34911188):102882. PubMed |