Anti HIVEP1 pAb (ATL-HPA067457)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067457-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: HIVEP1
Alternative Gene Name: CIRIP, CRYBP1, MBP-1, PRDII-BF1, Schnurri-1, ZAS1, ZNF40, ZNF40A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021366: 62%, ENSRNOG00000014460: 60%
Entrez Gene ID: 3096
Uniprot ID: P15822
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CFSGVHTDPMDVLPRALLTRMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVDTSRSPCHQMSVDYPESEEILRSSMAGKAV |
| Gene Sequence | CFSGVHTDPMDVLPRALLTRMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVDTSRSPCHQMSVDYPESEEILRSSMAGKAV |
| Gene ID - Mouse | ENSMUSG00000021366 |
| Gene ID - Rat | ENSRNOG00000014460 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HIVEP1 pAb (ATL-HPA067457) | |
| Datasheet | Anti HIVEP1 pAb (ATL-HPA067457) Datasheet (External Link) |
| Vendor Page | Anti HIVEP1 pAb (ATL-HPA067457) at Atlas Antibodies |
| Documents & Links for Anti HIVEP1 pAb (ATL-HPA067457) | |
| Datasheet | Anti HIVEP1 pAb (ATL-HPA067457) Datasheet (External Link) |
| Vendor Page | Anti HIVEP1 pAb (ATL-HPA067457) |