Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA068266-25
  • Immunohistochemical staining of human cerebral cortex, colon, kidney and testis using Anti-HIST1H1T antibody HPA068266 (A) shows similar protein distribution across tissues to independent antibody HPA065718 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: histone cluster 1, H1t
Gene Name: HIST1H1T
Alternative Gene Name: H1FT, H1t
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036211: 55%, ENSRNOG00000061863: 57%
Entrez Gene ID: 3010
Uniprot ID: P22492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS
Gene Sequence SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS
Gene ID - Mouse ENSMUSG00000036211
Gene ID - Rat ENSRNOG00000061863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation)
Datasheet Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIST1H1T pAb (ATL-HPA068266 w/enhanced validation)