Anti HINT3 pAb (ATL-HPA027914)

Atlas Antibodies

Catalog No.:
ATL-HPA027914-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: histidine triad nucleotide binding protein 3
Gene Name: HINT3
Alternative Gene Name: FLJ33126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019791: 47%, ENSRNOG00000014190: 58%
Entrez Gene ID: 135114
Uniprot ID: Q9NQE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP
Gene Sequence MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP
Gene ID - Mouse ENSMUSG00000019791
Gene ID - Rat ENSRNOG00000014190
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HINT3 pAb (ATL-HPA027914)
Datasheet Anti HINT3 pAb (ATL-HPA027914) Datasheet (External Link)
Vendor Page Anti HINT3 pAb (ATL-HPA027914) at Atlas Antibodies

Documents & Links for Anti HINT3 pAb (ATL-HPA027914)
Datasheet Anti HINT3 pAb (ATL-HPA027914) Datasheet (External Link)
Vendor Page Anti HINT3 pAb (ATL-HPA027914)