Anti HINT3 pAb (ATL-HPA027914)

Atlas Antibodies

Catalog No.: ATL-HPA027914-25

Protein Description: histidine triad nucleotide binding protein 3
Gene Name: HINT3
Alternative Gene Name: FLJ33126
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019791: 47%, ENSRNOG00000014190: 58%
Entrez Gene ID: 135114
Uniprot ID: Q9NQE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP
• Gene Sequence: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP
• Gene ID - Mouse: ENSMUSG00000019791
• Gene ID - Rat: ENSRNOG00000014190
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.