Anti HINT2 pAb (ATL-HPA020961 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020961-25

• 
• 
• 

Protein Description: histidine triad nucleotide binding protein 2
Gene Name: HINT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028470: 88%, ENSRNOG00000015866: 89%
Entrez Gene ID: 84681
Uniprot ID: Q9BX68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP
• Gene Sequence: IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP
• Gene ID - Mouse: ENSMUSG00000028470
• Gene ID - Rat: ENSRNOG00000015866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.