Anti HINFP pAb (ATL-HPA061008)

Atlas Antibodies

Catalog No.:
ATL-HPA061008-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: histone H4 transcription factor
Gene Name: HINFP
Alternative Gene Name: DKFZP434F162, HiNF-P, MIZF, ZNF743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032119: 83%, ENSRNOG00000009499: 83%
Entrez Gene ID: 25988
Uniprot ID: Q9BQA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
Gene Sequence GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
Gene ID - Mouse ENSMUSG00000032119
Gene ID - Rat ENSRNOG00000009499
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HINFP pAb (ATL-HPA061008)
Datasheet Anti HINFP pAb (ATL-HPA061008) Datasheet (External Link)
Vendor Page Anti HINFP pAb (ATL-HPA061008) at Atlas Antibodies

Documents & Links for Anti HINFP pAb (ATL-HPA061008)
Datasheet Anti HINFP pAb (ATL-HPA061008) Datasheet (External Link)
Vendor Page Anti HINFP pAb (ATL-HPA061008)