Anti HINFP pAb (ATL-HPA061008)

Atlas Antibodies

Catalog No.: ATL-HPA061008-100

Protein Description: histone H4 transcription factor
Gene Name: HINFP
Alternative Gene Name: DKFZP434F162, HiNF-P, MIZF, ZNF743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032119: 83%, ENSRNOG00000009499: 83%
Entrez Gene ID: 25988
Uniprot ID: Q9BQA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
• Gene Sequence: GHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLNESSLQGIILETVPGEPGRKE
• Gene ID - Mouse: ENSMUSG00000032119
• Gene ID - Rat: ENSRNOG00000009499
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.