Anti HILPDA pAb (ATL-HPA010515)

Atlas Antibodies

Catalog No.:
ATL-HPA010515-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hypoxia inducible lipid droplet-associated
Gene Name: HILPDA
Alternative Gene Name: C7orf68, FLJ21076, HIG-2, HIG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043421: 76%, ENSRNOG00000054999: 68%
Entrez Gene ID: 29923
Uniprot ID: Q9Y5L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
Gene Sequence LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
Gene ID - Mouse ENSMUSG00000043421
Gene ID - Rat ENSRNOG00000054999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HILPDA pAb (ATL-HPA010515)
Datasheet Anti HILPDA pAb (ATL-HPA010515) Datasheet (External Link)
Vendor Page Anti HILPDA pAb (ATL-HPA010515) at Atlas Antibodies

Documents & Links for Anti HILPDA pAb (ATL-HPA010515)
Datasheet Anti HILPDA pAb (ATL-HPA010515) Datasheet (External Link)
Vendor Page Anti HILPDA pAb (ATL-HPA010515)