Anti HILPDA pAb (ATL-HPA010515)
Atlas Antibodies
- Catalog No.:
- ATL-HPA010515-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: HILPDA
Alternative Gene Name: C7orf68, FLJ21076, HIG-2, HIG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043421: 76%, ENSRNOG00000054999: 68%
Entrez Gene ID: 29923
Uniprot ID: Q9Y5L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM |
Gene Sequence | LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM |
Gene ID - Mouse | ENSMUSG00000043421 |
Gene ID - Rat | ENSRNOG00000054999 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HILPDA pAb (ATL-HPA010515) | |
Datasheet | Anti HILPDA pAb (ATL-HPA010515) Datasheet (External Link) |
Vendor Page | Anti HILPDA pAb (ATL-HPA010515) at Atlas Antibodies |
Documents & Links for Anti HILPDA pAb (ATL-HPA010515) | |
Datasheet | Anti HILPDA pAb (ATL-HPA010515) Datasheet (External Link) |
Vendor Page | Anti HILPDA pAb (ATL-HPA010515) |