Anti HILPDA pAb (ATL-HPA010515)

Atlas Antibodies

SKU: ATL-HPA010515-25

• 

Protein Description: hypoxia inducible lipid droplet-associated
Gene Name: HILPDA
Alternative Gene Name: C7orf68, FLJ21076, HIG-2, HIG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043421: 76%, ENSRNOG00000054999: 68%
Entrez Gene ID: 29923
Uniprot ID: Q9Y5L2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
• Gene Sequence: LEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM
• Gene ID - Mouse: ENSMUSG00000043421
• Gene ID - Rat: ENSRNOG00000054999
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.