Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA065302-25
  • Immunohistochemistry analysis in human testis and liver tissues using Anti-HIF1AN antibody. Corresponding HIF1AN RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hypoxia inducible factor 1, alpha subunit inhibitor
Gene Name: HIF1AN
Alternative Gene Name: DKFZp762F1811, FIH1, FLJ20615, FLJ22027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036450: 96%, ENSRNOG00000014234: 97%
Entrez Gene ID: 55662
Uniprot ID: Q9NWT6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI
Gene Sequence YLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKI
Gene ID - Mouse ENSMUSG00000036450
Gene ID - Rat ENSRNOG00000014234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation)
Datasheet Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIF1AN pAb (ATL-HPA065302 w/enhanced validation)