Anti HIF1A pAb (ATL-HPA001275)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001275-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: HIF1A
Alternative Gene Name: bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021109: 87%, ENSRNOG00000008292: 88%
Entrez Gene ID: 3091
Uniprot ID: Q16665
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD |
| Gene Sequence | KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD |
| Gene ID - Mouse | ENSMUSG00000021109 |
| Gene ID - Rat | ENSRNOG00000008292 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HIF1A pAb (ATL-HPA001275) | |
| Datasheet | Anti HIF1A pAb (ATL-HPA001275) Datasheet (External Link) |
| Vendor Page | Anti HIF1A pAb (ATL-HPA001275) at Atlas Antibodies |
| Documents & Links for Anti HIF1A pAb (ATL-HPA001275) | |
| Datasheet | Anti HIF1A pAb (ATL-HPA001275) Datasheet (External Link) |
| Vendor Page | Anti HIF1A pAb (ATL-HPA001275) |
| Citations for Anti HIF1A pAb (ATL-HPA001275) – 10 Found |
| Benfeitas, Rui; Bidkhori, Gholamreza; Mukhopadhyay, Bani; Klevstig, Martina; Arif, Muhammad; Zhang, Cheng; Lee, Sunjae; Cinar, Resat; Nielsen, Jens; Uhlen, Mathias; Boren, Jan; Kunos, George; Mardinoglu, Adil. Characterization of heterogeneous redox responses in hepatocellular carcinoma patients using network analysis. Ebiomedicine. 2019;40( 30606699):471-487. PubMed |
| Merelli, Amalia; Ramos, Alberto Javier; Lazarowski, Alberto; Auzmendi, Jeronimo. Convulsive Stress Mimics Brain Hypoxia and Promotes the P-Glycoprotein (P-gp) and Erythropoietin Receptor Overexpression. Recombinant Human Erythropoietin Effect on P-gp Activity. Frontiers In Neuroscience. 13( 31379495):750. PubMed |
| Boso, Daniele; Rampazzo, Elena; Zanon, Carlo; Bresolin, Silvia; Maule, Francesca; Porcù, Elena; Cani, Alice; Della Puppa, Alessandro; Trentin, Luca; Basso, Giuseppe; Persano, Luca. HIF-1α/Wnt signaling-dependent control of gene transcription regulates neuronal differentiation of glioblastoma stem cells. Theranostics. 9(17):4860-4877. PubMed |
| Smyth, L G; O'Hurley, G; O'Grady, A; Fitzpatrick, J M; Kay, E; Watson, R W G. Carbonic anhydrase IX expression in prostate cancer. Prostate Cancer And Prostatic Diseases. 2010;13(2):178-81. PubMed |
| Zibert, John R; Wallbrecht, Katrin; Schön, Margarete; Mir, Lluis M; Jacobsen, Grete K; Trochon-Joseph, Veronique; Bouquet, Céline; Villadsen, Louise S; Cadossi, Ruggero; Skov, Lone; Schön, Michael P. Halting angiogenesis by non-viral somatic gene therapy alleviates psoriasis and murine psoriasiform skin lesions. The Journal Of Clinical Investigation. 2011;121(1):410-21. PubMed |
| Paatero, Ilkka; Jokilammi, Anne; Heikkinen, Pekka T; Iljin, Kristiina; Kallioniemi, Olli-Pekka; Jones, Frank E; Jaakkola, Panu M; Elenius, Klaus. Interaction with ErbB4 promotes hypoxia-inducible factor-1α signaling. The Journal Of Biological Chemistry. 2012;287(13):9659-9671. PubMed |
| Zbytek, Blazej; Peacock, Danielle L; Seagroves, Tiffany N; Slominski, Andrzej. Putative role of HIF transcriptional activity in melanocytes and melanoma biology. Dermato-Endocrinology. 2013;5(2):239-51. PubMed |
| Kurelac, Ivana; Iommarini, Luisa; Vatrinet, Renaud; Amato, Laura Benedetta; De Luise, Monica; Leone, Giulia; Girolimetti, Giulia; Umesh Ganesh, Nikkitha; Bridgeman, Victoria Louise; Ombrato, Luigi; Columbaro, Marta; Ragazzi, Moira; Gibellini, Lara; Sollazzo, Manuela; Feichtinger, Rene Gunther; Vidali, Silvia; Baldassarre, Maurizio; Foriel, Sarah; Vidone, Michele; Cossarizza, Andrea; Grifoni, Daniela; Kofler, Barbara; Malanchi, Ilaria; Porcelli, Anna Maria; Gasparre, Giuseppe. Inducing cancer indolence by targeting mitochondrial Complex I is potentiated by blocking macrophage-mediated adaptive responses. Nature Communications. 2019;10(1):903. PubMed |
| Wada, Yuma; Morine, Yuji; Imura, Satoru; Ikemoto, Tetsuya; Saito, Yu; Takasu, Chie; Yamada, Shinichiro; Shimada, Mitsuo. HIF-1α expression in liver metastasis but not primary colorectal cancer is associated with prognosis of patients with colorectal liver metastasis. World Journal Of Surgical Oncology. 2020;18(1):241. PubMed |
| Hagiwara, Akifumi; Yao, Jingwen; Raymond, Catalina; Cho, Nicholas S; Everson, Richard; Patel, Kunal; Morrow, Danielle H; Desousa, Brandon R; Mareninov, Sergey; Chun, Saewon; Nathanson, David A; Yong, William H; Andrei, Gafita; Divakaruni, Ajit S; Salamon, Noriko; Pope, Whitney B; Nghiemphu, Phioanh L; Liau, Linda M; Cloughesy, Timothy F; Ellingson, Benjamin M. "Aerobic glycolytic imaging" of human gliomas using combined pH-, oxygen-, and perfusion-weighted magnetic resonance imaging. Neuroimage. Clinical. 32( 34911188):102882. PubMed |