Anti HIC2 pAb (ATL-HPA059399)

Atlas Antibodies

Catalog No.:
ATL-HPA059399-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: hypermethylated in cancer 2
Gene Name: HIC2
Alternative Gene Name: HRG22, KIAA1020, ZBTB30, ZNF907
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050240: 80%, ENSRNOG00000051458: 81%
Entrez Gene ID: 23119
Uniprot ID: Q96JB3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIQARYQGLVDGRKGAHAPQELPQAKGSDDELFLGGSNQDSVQGLGRAVCPAGGEAGLGGCSSSTNGSSGGCEQELGLD
Gene Sequence VIQARYQGLVDGRKGAHAPQELPQAKGSDDELFLGGSNQDSVQGLGRAVCPAGGEAGLGGCSSSTNGSSGGCEQELGLD
Gene ID - Mouse ENSMUSG00000050240
Gene ID - Rat ENSRNOG00000051458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HIC2 pAb (ATL-HPA059399)
Datasheet Anti HIC2 pAb (ATL-HPA059399) Datasheet (External Link)
Vendor Page Anti HIC2 pAb (ATL-HPA059399) at Atlas Antibodies

Documents & Links for Anti HIC2 pAb (ATL-HPA059399)
Datasheet Anti HIC2 pAb (ATL-HPA059399) Datasheet (External Link)
Vendor Page Anti HIC2 pAb (ATL-HPA059399)