Anti HIBADH pAb (ATL-HPA021002 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021002-100
  • Immunohistochemical staining of human kidney, liver, lymph node and placenta using Anti-HIBADH antibody HPA021002 (A) shows similar protein distribution across tissues to independent antibody HPA019522 (B).
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: 3-hydroxyisobutyrate dehydrogenase
Gene Name: HIBADH
Alternative Gene Name: NS5ATP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029776: 93%, ENSRNOG00000008063: 93%
Entrez Gene ID: 11112
Uniprot ID: P31937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLR
Gene Sequence NPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLR
Gene ID - Mouse ENSMUSG00000029776
Gene ID - Rat ENSRNOG00000008063
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti HIBADH pAb (ATL-HPA021002 w/enhanced validation)
Datasheet Anti HIBADH pAb (ATL-HPA021002 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIBADH pAb (ATL-HPA021002 w/enhanced validation)



Citations for Anti HIBADH pAb (ATL-HPA021002 w/enhanced validation) – 1 Found
Tasi, Yung-Chieh; Chao, Hsin-Chih Albert; Chung, Chia-Ling; Liu, Xiu-Ying; Lin, Ying-Ming; Liao, Pao-Chi; Pan, Hsien-An; Chiang, Han-Sun; Kuo, Pao-Lin; Lin, Ying-Hung. Characterization of 3-hydroxyisobutyrate dehydrogenase, HIBADH, as a sperm-motility marker. Journal Of Assisted Reproduction And Genetics. 2013;30(4):505-12.  PubMed