Anti HIBADH pAb (ATL-HPA019522 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA019522-25
  • Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-HIBADH antibody. Corresponding HIBADH RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and HIBADH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407294).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: 3-hydroxyisobutyrate dehydrogenase
Gene Name: HIBADH
Alternative Gene Name: NS5ATP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029776: 96%, ENSRNOG00000008063: 94%
Entrez Gene ID: 11112
Uniprot ID: P31937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMS
Gene Sequence GNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMS
Gene ID - Mouse ENSMUSG00000029776
Gene ID - Rat ENSRNOG00000008063
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti HIBADH pAb (ATL-HPA019522 w/enhanced validation)
Datasheet Anti HIBADH pAb (ATL-HPA019522 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HIBADH pAb (ATL-HPA019522 w/enhanced validation)