Anti HHLA1 pAb (ATL-HPA059051)

Atlas Antibodies

Catalog No.:
ATL-HPA059051-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: HERV-H LTR-associating 1
Gene Name: HHLA1
Alternative Gene Name: PLA2L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072511: 89%, ENSRNOG00000054588: 89%
Entrez Gene ID: 10086
Uniprot ID: C9JL84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ISNLKTVDPAKFPTRYCYCLNNRTNDLSDFTALLVDIIGNSTSYLTEIFKSTSILSVNQSNESDCIFICVMTGKSGRNLSDFWEI
Gene Sequence ISNLKTVDPAKFPTRYCYCLNNRTNDLSDFTALLVDIIGNSTSYLTEIFKSTSILSVNQSNESDCIFICVMTGKSGRNLSDFWEI
Gene ID - Mouse ENSMUSG00000072511
Gene ID - Rat ENSRNOG00000054588
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HHLA1 pAb (ATL-HPA059051)
Datasheet Anti HHLA1 pAb (ATL-HPA059051) Datasheet (External Link)
Vendor Page Anti HHLA1 pAb (ATL-HPA059051) at Atlas Antibodies

Documents & Links for Anti HHLA1 pAb (ATL-HPA059051)
Datasheet Anti HHLA1 pAb (ATL-HPA059051) Datasheet (External Link)
Vendor Page Anti HHLA1 pAb (ATL-HPA059051)