Anti HGS pAb (ATL-HPA007728)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007728-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: HGS
Alternative Gene Name: Hrs, Vps27, ZFYVE8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025793: 99%, ENSRNOG00000036696: 99%
Entrez Gene ID: 9146
Uniprot ID: O14964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCS |
| Gene Sequence | PHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCS |
| Gene ID - Mouse | ENSMUSG00000025793 |
| Gene ID - Rat | ENSRNOG00000036696 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti HGS pAb (ATL-HPA007728) | |
| Datasheet | Anti HGS pAb (ATL-HPA007728) Datasheet (External Link) |
| Vendor Page | Anti HGS pAb (ATL-HPA007728) at Atlas Antibodies |
| Documents & Links for Anti HGS pAb (ATL-HPA007728) | |
| Datasheet | Anti HGS pAb (ATL-HPA007728) Datasheet (External Link) |
| Vendor Page | Anti HGS pAb (ATL-HPA007728) |
| Citations for Anti HGS pAb (ATL-HPA007728) – 1 Found |
| Roux, Benoît T; Bauer, Claudia C; McNeish, Alister J; Ward, Stephen G; Cottrell, Graeme S. The Role of Ubiquitination and Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate in the Degradation of the Adrenomedullin Type I Receptor. Scientific Reports. 2017;7(1):12389. PubMed |