Anti HGS pAb (ATL-HPA007728)

Atlas Antibodies

Catalog No.:
ATL-HPA007728-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: hepatocyte growth factor-regulated tyrosine kinase substrate
Gene Name: HGS
Alternative Gene Name: Hrs, Vps27, ZFYVE8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025793: 99%, ENSRNOG00000036696: 99%
Entrez Gene ID: 9146
Uniprot ID: O14964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCS
Gene Sequence PHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCS
Gene ID - Mouse ENSMUSG00000025793
Gene ID - Rat ENSRNOG00000036696
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HGS pAb (ATL-HPA007728)
Datasheet Anti HGS pAb (ATL-HPA007728) Datasheet (External Link)
Vendor Page Anti HGS pAb (ATL-HPA007728) at Atlas Antibodies

Documents & Links for Anti HGS pAb (ATL-HPA007728)
Datasheet Anti HGS pAb (ATL-HPA007728) Datasheet (External Link)
Vendor Page Anti HGS pAb (ATL-HPA007728)
Citations for Anti HGS pAb (ATL-HPA007728) – 1 Found
Roux, Benoît T; Bauer, Claudia C; McNeish, Alister J; Ward, Stephen G; Cottrell, Graeme S. The Role of Ubiquitination and Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate in the Degradation of the Adrenomedullin Type I Receptor. Scientific Reports. 2017;7(1):12389.  PubMed