Anti HGS pAb (ATL-HPA004872 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA004872-25

• 
• 
• 

Protein Description: hepatocyte growth factor-regulated tyrosine kinase substrate
Gene Name: HGS
Alternative Gene Name: Hrs, Vps27, ZFYVE8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025793: 89%, ENSRNOG00000036696: 89%
Entrez Gene ID: 9146
Uniprot ID: O14964
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDS
• Gene Sequence: LAEDIDPELARYLNRNYWEKKQEEARKSPTPSAPVPLTEPAAQPGEGHAAPTNVVENPLPETDSQPIPPSGGPFSEPQFHNGESEESHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDS
• Gene ID - Mouse: ENSMUSG00000025793
• Gene ID - Rat: ENSRNOG00000036696
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HGS pAb (ATL-HPA004872 w/enhanced validation) – 1 Found

Brockmeyer, Claudia; Paster, Wolfgang; Pepper, David; Tan, Choon P; Trudgian, David C; McGowan, Simon; Fu, Guo; Gascoigne, Nicholas R J; Acuto, Oreste; Salek, Mogjiborahman. T cell receptor (TCR)-induced tyrosine phosphorylation dynamics identifies THEMIS as a new TCR signalosome component. The Journal Of Biological Chemistry. 2011;286(9):7535-47.