Anti HGD pAb (ATL-HPA052359 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA052359-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: homogentisate 1,2-dioxygenase
Gene Name: HGD
Alternative Gene Name: AKU, HGO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022821: 94%, ENSRNOG00000002701: 89%
Entrez Gene ID: 3081
Uniprot ID: Q93099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQ
Gene Sequence AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQ
Gene ID - Mouse ENSMUSG00000022821
Gene ID - Rat ENSRNOG00000002701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti HGD pAb (ATL-HPA052359 w/enhanced validation)
Datasheet Anti HGD pAb (ATL-HPA052359 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HGD pAb (ATL-HPA052359 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HGD pAb (ATL-HPA052359 w/enhanced validation)
Datasheet Anti HGD pAb (ATL-HPA052359 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HGD pAb (ATL-HPA052359 w/enhanced validation)
Citations for Anti HGD pAb (ATL-HPA052359 w/enhanced validation) – 1 Found
Lequeue, Sien; Neuckermans, Jessie; Nulmans, Ine; Schwaneberg, Ulrich; Vanhaecke, Tamara; De Kock, Joery. A robust bacterial high-throughput screening system to evaluate single nucleotide polymorphisms of human homogentisate 1,2-dioxygenase in the context of alkaptonuria. Scientific Reports. 2022;12(1):19452.  PubMed