Anti HGD pAb (ATL-HPA052359 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052359-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: HGD
Alternative Gene Name: AKU, HGO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022821: 94%, ENSRNOG00000002701: 89%
Entrez Gene ID: 3081
Uniprot ID: Q93099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQ |
Gene Sequence | AELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQ |
Gene ID - Mouse | ENSMUSG00000022821 |
Gene ID - Rat | ENSRNOG00000002701 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HGD pAb (ATL-HPA052359 w/enhanced validation) | |
Datasheet | Anti HGD pAb (ATL-HPA052359 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HGD pAb (ATL-HPA052359 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti HGD pAb (ATL-HPA052359 w/enhanced validation) | |
Datasheet | Anti HGD pAb (ATL-HPA052359 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HGD pAb (ATL-HPA052359 w/enhanced validation) |
Citations for Anti HGD pAb (ATL-HPA052359 w/enhanced validation) – 1 Found |
Lequeue, Sien; Neuckermans, Jessie; Nulmans, Ine; Schwaneberg, Ulrich; Vanhaecke, Tamara; De Kock, Joery. A robust bacterial high-throughput screening system to evaluate single nucleotide polymorphisms of human homogentisate 1,2-dioxygenase in the context of alkaptonuria. Scientific Reports. 2022;12(1):19452. PubMed |